|
not listed in any blacklists
updated: May 27, 2012 8:21:37 PM
| blocklist | link | status | description | | green | | bl.deadbeef.com | | | |
| in.dnsbl.org | | | |
| ex.dnsbl.org | | | |
| zebl.zoneedit.com | | | |
| rddn.dnsbl.net.au | | | |
| postmaster.rfc-ignorant.org | link | | |
| dsn.rfc-ignorant.org | link | | |
| abuse.rfc-ignorant.org | link | | |
| whois.rfc-ignorant.org | link | | |
| bogusmx.rfc-ignorant.org | link | | |
| badconf.rhsbl.sorbs.net | | | |
| nomail.rhsbl.sorbs.net | | | |
| rhsbl.ahbl.org | | | |
| jwrh.dnsbl.net.au | | | |
| dnsrbl.swinog.ch | link | | |
| multi.surbl.org | link | | |
| dyndns.rbl.jp | | | |
Check that your domain name or IP number is not listed in any rbl / dnsbl and protect against false spam listings.
whois ip and domain information about momkilledincarcrashlawyerphiladelphia.info domain info api
dns delegation
rtsakmarkb
Your IP is: ...
and you are in ...
|